Axon
Axon~2mo ago
USD 148500-237600/yr

Senior Software Engineer I, (Discovery)

United StatesUnited States·Seattlesenior
OtherSoftware EngineerSoftware Engineering
6 views0 saves0 applied

Quick Summary

Overview

Join Axon and be a Force for Good. At Axon, we’re on a mission to Protect Life. We’re explorers, pursuing society’s most critical safety and justice issues with our ecosystem of devices and cloud software. Like our products, we work better together.

Requirements Summary

Bachelor's Degree in Computer Science, Engineering, or related field 10+ years of professional software development experience Experience designing and delivering highly-available, scalable cloud-based systems Backend service experience in multiple,…

Technical Tools
csharpelasticsearchgographqljavakafkascalasqltypescriptmentoring

At Axon, we’re on a mission to Protect Life. We’re explorers, pursuing society’s most critical safety and justice issues with our ecosystem of devices and cloud software. Like our products, we work better together. We connect with candor and care, seeking out diverse perspectives from our customers, communities and each other.

Life at Axon is fast-paced, challenging and meaningful. Here, you’ll take ownership and drive real change. Constantly grow as you work hard for a mission that matters at a company where you matter.

Today, public safety officers spend up to 2/3 of their time on the job filling out paperwork (sometimes with paper, sometimes with floppy disks). Not only is this tedious for officers, but the never-ending pile of paperwork reduces the amount of time they can spend out in the field, protecting their communities. Axon Records cuts down on paperwork so that officers can spend more time prioritizing the safety of our communities.

On the Axon Records Discovery Squad, we’re building a high-performance, scalable search and insights platform to help law enforcement officers find accurate, relevant information for all of the questions they have on the job.

Imagine the year 2030. Advanced technology has automated more and more routine tasks to put officers back in the community, dramatically improving the quality and safety of our lives. Public safety officers have everything available at their fingertips- empowering them to seamlessly connect the dots and get the answers they need, when they need them, to most effectively protect life.

As a Senior Engineer on the Discovery Squad, you’ll work closely with software engineers, product managers and designers to ensure the Records data is easy for users to locate and analyze. You’ll work on major technical projects with large data volumes, lead the implementation of new features, and help shape our team culture and engineering processes.

Join us to work with a passionate, mission-driven group of folks who want to positively impact the lives of first responders and those that they serve.

Responsibilities

~1 min read

About the Role

~2 min read

The above job description is not intended as, nor should it be construed as, exhaustive of all duties, responsibilities, skills, efforts, or working conditions associated with this job. The job description may change or be supplemented at any time in accordance with business needs and conditions.

Some roles may also require legal eligibility to work in a firearms environment.

We collect personal information from applicants to evaluate candidates for employment. You may request access, deletion, or exercise other CCPA rights at axongreenhousesupport@axon.com or via our Axon Privacy Web Form. For more information, please see the Your California Privacy Rights section of our Applicant and Candidate Privacy Notice.

Axon’s mission is to Protect Life and is committed to the well-being and safety of its employees as well as Axon’s impact on the environment. All Axon employees must be aware of and committed to the appropriate environmental, health, and safety regulations, policies, and procedures. Axon employees are empowered to report safety concerns as they arise and activities potentially impacting the environment.

We are an equal opportunity employer that promotes justice, advances equity, values diversity and fosters inclusion. We’re committed to hiring the best talent — regardless of race, creed, color, ancestry, religion, sex (including pregnancy), national origin, sexual orientation, age, citizenship status, marital status, disability, gender identity, genetic information, veteran status, or any other characteristic protected by applicable laws, regulations and ordinances — and empowering all of our employees so they can do their best work. If you have a disability or special need that requires assistance or accommodation during the application or the recruiting process, please email recruitingops@axon.com.  Please note that this email address is for accommodation purposes only. Axon will not respond to inquiries for other purposes.

Phishing alert:  Axon will never ask you to pay for any part of the hiring process, including training, equipment, or background checks. We do not make job offers via text message, WhatsApp, or instant messaging platforms without a formal interview process.  All legitimate job openings are listed on our official careers page at https://www.axon.com/careers.  If you receive a suspicious offer or outreach from an email address that is not @axon.com, or if you are asked for sensitive personal information (bank details, Social Security Number) prematurely, please ignore the message and report it to recruitingops@axon.com.

 

Location & Eligibility

Where is the job
Seattle, United States
On-site at the office
Who can apply
US
Listed under
United States

Listing Details

First seen
March 26, 2026
Last seen
June 18, 2026

Posting Health

Days active
83
Repost count
0
Trust Level
42%
Scored at
June 18, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Axon
Axon
greenhouse

Axon Enterprise, Inc. develops technology and weapons products for military, law enforcement, and civilians, including TASER devices, body-worn cameras, and cloud-based evidence management software.

Employees
3k+
Founded
1993
Domain
axon.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

AxonSenior Software Engineer I, (Discovery)USD 148500-237600