bunch
bunch1d ago
New

(Senior) Frontend Engineer (m/f/d)

Berlinfull-timesenior
OtherSenior Frontend Engineer
0 views0 saves0 applied

Quick Summary

Overview

bunch is building the backbone of private markets, combining exceptional expertise, operational excellence, and frictionless technology. The platform enables funds and private investors to seamlessly and securely set up and manage their investment entities.We are looking for a (Senior) Frontend…

Requirements Summary

Previous exposure to fintech or highly regulated domains Experience with zod (or any other form validation tools) Worked with data visualisations (e.g., tables, charts) Our tech stack Frontend: Svelte + SvelteKit but moving towards React + TanStack,…

Technical Tools
awsjavascriptkubernetesmysqlnestjsplaywrightreactsveltetypescriptfintechroadmap-planning

bunch is building the backbone of private markets, combining exceptional expertise, operational excellence, and frictionless technology. The platform enables funds and private investors to seamlessly and securely set up and manage their investment entities.

We are looking for a (Senior) Frontend Engineer who wants to play a pivotal role in growing our business and transforming the private markets industry.

You’ll be at the forefront of building the frontend experience that powers bunch. We’re looking for someone who sees product development as a craft - a blend of technical excellence, user-centered thinking, and cross-functional collaboration.

Whether you’re shaping architecture, maintaining our Design System, or implementing features from scratch, your work will have a direct impact on thousands of users managing billions in assets. We offer you freedom and ownership to build the right solutions and influence the product roadmap.

Responsibilities

~1 min read
  • Build robust, scalable, and well-tested frontend applications using modern frontend frameworks and our in-house Design System

  • Collaborate with PMs, Designers, and QAs in a cross-functional team to ship high-quality features quickly

  • Contribute to and evolve our frontend architecture, tooling, and design system

  • Ensure a great developer experience and continuously improve performance and reliability

  • Write meaningful unit and E2E tests

  • Actively shape product solutions by participating in discovery, feedback rounds, and design critiques

  • Take ownership of the frontend domain, influence platform-wide decisions

  • Drive alignment between design and development, and collaborate on challenging UX cases

  • Own and evolve our in-house Design System alongside the design team

  • Guide the team in architecture and performance decisions

  • Mentor and support other engineers

To thrive in our Product Development team, you combine a love for building excellent UIs with a pragmatic, product-first mindset. You're a strong communicator, a team player, and someone who thrives in a growing, fast-paced environment where asking "why" is encouraged.

  • Have 3+ years (Mid) or 5+ years (Senior) of experience building frontend applications

  • Are fluent in TypeScript and comfortable with modern frontend frameworks

  • Have experience working with Design Systems

    • for Senior: also experience building or maintaining custom ones

  • Are familiar with unit and E2E testing (Vitest, Playwright, or equivalents)

  • Understand UI/UX principles and care about building elegant, accessible, and usable interfaces

  • Can operate in ambiguity and turn loosely defined ideas into working software

  • Have experience in a startup or scaleup environment

Nice to Have

~1 min read
  • Previous exposure to fintech or highly regulated domains

  • Experience with zod (or any other form validation tools)

  • Worked with data visualisations (e.g., tables, charts)

  • FusionAuth for authentication

  • Retool for low-code internal frontend solutions

  • Twilio and SendGrid for sending SMS and emails

  • Tally for creating custom forms

  • Become one of the key builders of bunch and architect our go-to-market strategy

  • Take part in a network of people passionate about investment and work closely with the most interesting players in the private market

  • Benefit from working with a diverse mix of talents, unrivaled energy, and team spirit within a culture of inclusion

  • Flexible hours and a hybrid office setup (3 days/week in office)

  • 4 remote calendar weeks/year

  • 28 days of vacation, 2 company days, plus local public holidays

  • A competitive compensation package

  • A great tech and work setup with everything you need

Responsibilities

~1 min read
  • First interview with the People team (20 min): get acquainted with the bunch and to understand if what we’re offering is what you’re searching for

  • Hiring Manager Interview (60 min): this conversation with an Engineering Manager will cover product-focused culture and values, including collaboration, ownership, self-awareness, and quality standards.

  • Technical Interview (60 min): this interview in the form of a technical conversation with two engineers will focus on collaborative problem-solving, starting with open-ended questions and progressing to more specific challenges or short algorithm tasks.

  • Final Round: Meet our VP of Engineering (45 min) to learn about ways of working, vision for bunch, and team culture.

  • Meet-and-Greet (Optional - 30 min) to meet a few members of your future cross-functional team.

bunch is Europe’s leading tech-enabled fund administrator for VC, PE, and alternative assets. By combining AI-powered automation with deep domain expertise, we provide a single source of truth that replaces outdated, fragmented processes, and enables clients to master the entire fund lifecycle.

Private markets are experiencing unprecedented growth; with alternative assets projected to reach $40 trillion by the end of the decade. To power this growth, we have raised €22.8 million to date—including our $15.5M Series A in July 2024—and are accelerating our mission to build the backbone of private markets in Europe.

Founded in 2021 and headquartered in Berlin, bunch has expanded to Amsterdam, London, and Luxembourg, now supporting over 500 investment structures, 150 fund and asset managers, and more than 10,000 investors. As we prepare for our next stage of growth, we are looking for ambitious talent to continue redefining this financial category.

At bunch, we are committed to creating an inclusive environment for all employees because we value and celebrate diversity. We are an equal opportunity employer, which means we do not tolerate discrimination toward any of our applicants or employees.

Location & Eligibility

Where is the job
Berlin
On-site at the office
Who can apply
Same as job location

Listing Details

Posted
May 12, 2026
First seen
May 12, 2026
Last seen
May 13, 2026

Posting Health

Days active
0
Repost count
0
Trust Level
52%
Scored at
May 12, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

bunch(Senior) Frontend Engineer (m/f/d)