Hophr
Hophr7mo ago

Engineering Manager, Director

MexicoMexico·MonterreyFull- Timeexecutive
EngineeringManagementEngineering Manager
4 views0 saves0 applied

Quick Summary

Overview

As a leading global financial information services provider, our client delivers vital credit and risk insights, robust data, and dynamic tools to champion more efficient, transparent financial markets.

Technical Tools
argocdawsazurefastapigraphqlkafkapandaspythonredissnowflakesparkci-cdcode-reviewdatabase-designetlmentoringmicroservicesnetworkingproject-management
As a leading global financial information services provider, our client delivers vital credit and risk insights, robust data, and dynamic tools to champion more efficient, transparent financial markets. With over 100 years of experience and colleagues in over 30 countries, our client’s culture of credibility, independence, and transparency is embedded throughout its structure, which includes our client Ratings, one of the world’s top three credit ratings agencies, and our client Solutions, a leading provider of insights, data, and analytics. With dual headquarters in London and New York, our client is owned by Hearst. 

Our client's Technology & Data Team is a dynamic department where innovation meets impact. Our team includes the Chief Data Office, Chief Software Office, Chief Technology Office, Emerging Technology, Shared Technology Services, Technology, Risk, and the Executive Program Management Office (EPMO). Driven by our investment in cutting-edge technologies like AI and cloud solutions, we’re home to a diverse range of roles and backgrounds united by a shared passion for leveraging modern technology to drive projects that matter to our organization and clients. We are also proud to be recognized by Built In as a “Best Place to Work in Technology” 3 years in a row. Whether you're an experienced professional or just starting your career, we offer an exciting and supportive environment where you can grow, innovate, and make a difference. 
  • Hands-On Lead and mentor a high-performing data engineering team, fostering technical excellence and professional growth while ensuring delivery of scalable, modern data solutions aligned with business priorities.
  • Partner with the CDO team and data product leaders to define and execute the vision for an AWS-based data platform that enables enterprise-wide self-service, unlocking data for AI, analytics, and innovation.
  • Drive architectural decisions and establish best practices for data ingestion, transformation, and distribution frameworks that accelerate time-to-insight for data producers and consumers.
  • Champion adoption of emerging technologies such as Agentic AI and Generative AI, integrating advanced capabilities into data workflows to enhance user experience and position the organization as “AI-Ready.”
  • Ensure operational excellence and reliability by proactively addressing complex data engineering challenges, implementing robust quality controls, and preventing production incidents.
  • 7-10 years’ experience, hands-on, leading highly technical data-centric software engineers, preferably in financial services, in support of Data Lake houses (e.g. AWS, Databricks, Snowflake), data virtualization solutions (e.g. Starburst), modern data catalogs & data quality capabilities (e.g. Collibra), and Master Data Management (e.g. Informatica).
  • Proven AWS expertise (S3, EKS, Lambda, Glue, EMR, Redshift, S3, RDS/Aurora, Valkey/Redis, Step Functions, MSK/Kafka, Event Bridge).
  • AWS Certification strongly preferred.
  • Experience applying AI/ML to boost engineering productivity (e.g., GitHub Copilot, Amazon Q).
  • Strong Python for data engineering (Pandas, Spark/PySpark) and API Development (FastAPI or similar).
  • Design and build high-performance REST/GraphQL APIs with optimized query patterns, pagination, caching, and schema design to ensure low-latency, performant reads at scale.
  • Build ETL/ELT pipelines for batch and streaming; Kafka/MSK with schemas (Avro/JSON) and delivery semantics.
  • Optimize performance of object-based and relational datastores.
  • Design applications with microservices and a containerization mindset with ‘decoupling’ architectural principles.
  • Caching with Valkey/Redis: TTL strategies, invalidation, key design.
  • CI/CD and IaC with GitHub, Git/GitHub workflows, ArgoCD.
  • Security and reliability: IAM, KMS, secrets, VPC networking, observability (OpenTelemetry), SLOs, cost governance.
  • Ability to solve complex data-driven requirements and triage towards defects and production bugs.
  • Technology solutions and tools, including data governance and catalog solutions (e.g., Collibra, Alation, data platform and lake(house) (i.e., medallion’s architecture), and data mesh and virtualization tools (e.g., Starburst, Denodo).
  • Experience in leading the evaluation of new technologies and methodologies to enhance efficiency. (“Buy” vs “Build”).
  • Hands-on experience building AI agents (e.g., using LangGraph or LlamaIndex), implementing RAG over enterprise data, and enforcing robust guardrails through rigorous testing and evaluation, including Agentic AIconnection protocols (e.g., MCP, A2A).
  • Applying AI/ML to boost engineering productivity (e.g., GitHub Copilot, Amazon Q) and using agentic AI to automate workflows such as code reviews, test generation, data quality checks, and runbook execution.
  • Knowledge on SSO implementation and Azure AD (MS Entra) groups.
  • Great communication and collaboration skills.
  • Proven ability to drive innovation and install a culture of ‘continuous improvement’ that measurably improves business outcomes.
  • Ability to communicate effectively & translate technical concepts to senior management & non-technical stakeholders.
  • Work-Life Balance First: 40% in-office monthly stay connected while keeping flexibility.
  • A Culture of Learning & Mobility: Dedicated training, leadership development, and mentorship programs designed to ensure that your time at our client will be a continuous learning opportunity.
  • Investing in Your Future: Retirement planning and tuition reimbursement programs that empower you to achieve your short and long-term goals.
  • Promoting Health & Well-being: Comprehensive healthcare offerings that enable physical, mental, financial, social, and occupational well-being.
  • Supportive Parenting Policies: Family-friendly policies, including a generous global parental leave plan, are designed to help you balance career and family life effectively.
  • Inclusive Work Environment: A collaborative workplace where all voices are valued, with Employee Resource Groups that unite and empower our colleagues around the globe.
  • Dedication to Giving Back: Paid volunteer days, matched funding for donations, and ample opportunities to volunteer in your community.

  • Our client is committed to providing global securities markets with objective, timely, independent, and forward-looking credit opinions. To protect our client’s credibility and reputation, our employees must take every precaution to avoid conflicts of interest or any appearance of a conflict of interest. Should you be successful in the recruitment process at our client Ratings, you will be asked to declare any securities holdings and other potential conflicts prior to commencing employment. If you, or your immediate family, have any holdings that may conflict with your work responsibilities, you may be asked to divest yourself of them before beginning work.

    Our client is proud to be an Equal Opportunity and Affirmative Action Employer. We evaluatequalified applicants without regard to race, color, national origin, religion, sex, sexual orientation, gender identity, disability, protected veteran status, and other statuses protected by law. 

    Location & Eligibility

    Where is the job
    Monterrey, Mexico
    Hybrid — some on-site time required
    Who can apply
    MX
    Listed under
    Worldwide

    Listing Details

    Posted
    January 29, 2026
    First seen
    March 26, 2026
    Last seen
    September 5, 2026

    Posting Health

    Days active
    163
    Repost count
    0
    Trust Level
    33%
    Scored at
    September 5, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Hophr
    Hophr
    lever

    HopHR specializes in connecting businesses with high-caliber AI and Machine Learning talent, leveraging a rigorous vetting process to ensure top-quality placements.

    Employees
    125
    Founded
    2016
    Domain
    hophr.com
    View company profile
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    HophrEngineering Manager, Director