Hypebeast7mo ago
Software Engineer - PHP, JavaScript
Software EngineerSoftware Engineering
9 views0 saves0 applied
Quick Summary
Overview
Hypebeast is a leading global platform for contemporary culture and lifestyle, and a premier destination for editorially-driven news and commerce. Founded in 2005, it became a publicly listed company in 2016, and today boasts a global readership across North America, Asia Pacific, Europe and more.
Technical Tools
awselasticsearchjavascriptlaravelmysqlphptypescriptvueapi-designdatabase-designecommerce
Hypebeast is a leading global platform for contemporary culture and lifestyle, and a premier destination for editorially-driven news and commerce. Founded in 2005, it became a publicly listed company in 2016, and today boasts a global readership across North America, Asia Pacific, Europe and more. The Group has expanded its publishing brands to a wider scope, encompassing Hypebeast and its multiple content distribution platforms, creative agency Hypemaker, and e-commerce and retail platform HBX.
We’re hiring a Mid-Senior Software Engineer (Full Stack) to own and evolve our e-commerce platform. This is a domain-heavy role where you’ll build business-critical capabilities end-to-end—from product discovery to checkout to post-purchase workflows—while integrating with our app team and ERP systems.
You’ll thrive here if you care about engineering craft, take full ownership after release, and can operate with high autonomy.
If you think you’ve got what it takes, please provide your cover letter, CV and expected salary.
This position is based and located in Hong Kong. Candidate must be eligible to work in Hong Kong.
Personal data collected is for recruitment purposes only.
---
Location & Eligibility
Where is the job
Hong Kong
On-site within the country
Who can apply
HK
Listed under
Hong Kong
Listing Details
- Posted
- January 22, 2026
- First seen
- March 26, 2026
- Last seen
- August 14, 2026
Posting Health
- Days active
- 169
- Repost count
- 0
- Trust Level
- 31%
- Scored at
- September 11, 2026
Signal breakdown
freshnesssource trustcontent trustemployer trust

Hypebeast
lever
Hypebeast Ltd, founded in 2005, is a leading platform for contemporary culture and lifestyle, expanding from a sneaker blog into a multi-faceted media and e-commerce company.
View company profileExternal application · ~5 min on Hypebeast's site
Please let Hypebeast know you found this job on Jobera.
4 other jobs at Hypebeast
View all →Explore open roles at Hypebeast.
Similar Software Engineer jobs
View all →B
BoxSoftware Engineer III, Network Platform
USD 165000-206500
Senior Software Engineer II - Risk
Full TimeRemote
Senior Software Engineer
Senior Software Engineer, Core Engine
USD 196750-243290
Senior Software Engineer — Infra Agent Systems Remote India
Staff+ Software Engineer, Developer Experience
USD 405000-485000
Browse Similar Jobs
Java Developer373Solutions Architect308Salesforce Developer200Application Developer197.Net Developer177Php Developer154Python Developer144Security Software Engineer112Laravel Developer111Full Stack Developer98Java Software Engineer81C++ Developer64Embedded Software Engineer63Build Engineer60Integration Developer60Robotics Software Engineer52Wordpress Developer49Search Engineer46Database Developer40Low-Code Developer37
Newsletter
Stay ahead of the market
Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.
A
B
C
D
No spam. Unsubscribe at any time.