Nice
Nice18h ago
New↻ Repost

Specialist Automation Engineer, CX

India - Punemid
EngineeringAutomation Engineer
0 views0 saves0 applied

Quick Summary

Overview

At NiCE, we don’t limit our challenges. We challenge our limits. Always. We’re ambitious. We’re game changers. And we play to win. We set the highest standards and execute beyond them. And if you’re like us, we can offer you the ultimate career opportunity that will light a fire within you.

Technical Tools
awsjavascriptplaywrightsqltypescriptagileci-cdmicroservices

At NiCE, we don’t limit our challenges. We challenge our limits. Always. We’re ambitious. We’re game changers. And we play to win. We set the highest standards and execute beyond them. And if you’re like us, we can offer you the ultimate career opportunity that will light a fire within you.

As a Specialist Automation Engineer. You will be part of a cross-functional Scrum team that develops and supports specific components of our end product. You will be working hand in hand with the other R&D people. You will be involved in new feature development; provide input to POs and developers on the correct behavior of the system. You own the quality of the product, taking full responsibility for all functional – but also non-functional – aspects, like performance, stability, security, and maintainability. Serve as the quality leader for the group and is accountable for the product quality. Drive the team for continues improvement and innovate with quality assurance practices.

 

Drive an AI-first quality mindset, leveraging automation and data insights to improve testing, defect detection, and overall product quality

Design and execute AI-assisted test strategies (manual, automation, unit, integration, E2E, exploratory) for web and backend to ensure strong coverage

Requirements

~1 min read

B.E./B.Tech in Computer Science, Industrial, or Electronics Engineering

8–11 years of experience as an Automation QA Engineer

Strong experience in test planning and execution for scalable applications

Hands-on with Playwright (TypeScript/JavaScript); knowledge of Java/JavaScript is a plus

Experience with AI-driven testing approaches and test management tools (TestLink, Xray)

Good understanding of Agile (Scrum/Kanban) methodologies

Experience with API testing (Postman), SQL, and microservices architecture

Familiarity with virtual environments, Windows, and shell operations

Hands-on in functional and non-functional testing with a strong quality mindset

 

Experience in web & backend testing

Knowledge of HTTP and cloud (AWS preferred)

Exposure to Telecom/UC systems

Experience in risk-based testing & CI/CD

ISTQB/ISEB/TMap certification is a plus

Join an ever-growing, market disrupting, global company where the teams – comprised of the best of the best – work in a fast-paced, collaborative, and creative environment! As the market leader, every day at NICE is a chance to learn and grow, and there are endless internal career opportunities across multiple roles, disciplines, domains, and locations. If you are passionate, innovative, and excited to constantly raise the bar, you may just be our next NICEr!

At NICE, we work according to the NICE-FLEX hybrid model, which enables maximum flexibility: 2 days working from the office and 3 days of remote work, each week. Naturally, office days focus on face-to-face meetings, where teamwork and collaborative thinking generate innovation, new ideas, and a vibrant, interactive atmosphere.


Requisition ID:
10799

Reporting into:  Tech Manager
Role Type: Individual Contributor

About NiCE

NICE Ltd. (NASDAQ: NICE) software products are used by 25,000+ global businesses, including 85 of the Fortune 100 corporations, to deliver extraordinary customer experiences, fight financial crime and ensure public safety. Every day, NiCE software manages more than 120 million customer interactions and monitors 3+ billion financial transactions.

Known as an innovation powerhouse that excels in AI, cloud and digital, NiCE is consistently recognized as the market leader in its domains, with over 8,500 employees across 30+ countries.

NiCE is proud to be an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, national origin, age, sex, marital status, ancestry, neurotype, physical or mental disability, veteran status, gender identity, sexual orientation or any other category protected by law.

 

Location & Eligibility

Where is the job
India - Pune
On-site at the office
Who can apply
Same as job location

Listing Details

Posted
May 8, 2026
First seen
May 8, 2026
Last seen
May 8, 2026

Posting Health

Days active
0
Repost count
1
Trust Level
61%
Scored at
May 8, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Nice
Nice
greenhouse

NICE Ltd. specializes in customer experience management with a focus on AI-driven solutions.

Employees
8k+
Founded
1986
Domain
nice.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

NiceSpecialist Automation Engineer, CX