Stackblitz
Stackblitz~5mo ago

Engineering Manager - Front-End (UI/UX)

Remotelead
EngineeringDesignOtherFrontend EngineeringEngineering ManagerFrontend Developer
13 views0 saves0 applied

Quick Summary

Overview

🚀 About Us We’re Bolt.new by StackBlitz! We’re the team behind WebContainers, the groundbreaking technology that made it possible to run Node.js right in your browser. No installs, no setup, just instant dev environments.

Technical Tools
anthropicfigmajavascriptreactsketchtypescriptperformance-managementperformance-optimization

We’re Bolt.new by StackBlitz!

We’re the team behind WebContainers, the groundbreaking technology that made it possible to run Node.js right in your browser. No installs, no setup, just instant dev environments. That innovation kickstarted our journey in 2019 and powers the blazing-fast online IDE used by over a million developers every month.

But we didn’t stop there.

We took everything we learned from building WebContainers and used it to create Bolt.new. The fastest way to go from idea to production without writing traditional code. Think of it as the Canva or Figma for full-stack applications: a next-gen, AI-powered builder that lets you create, edit, and deploy web and mobile apps instantly, right in your browser.

WebContainers make it possible. Bolt.new brings it to life. Together, they reimagine what it means to build software lowering the barrier to entry, speeding up workflows, and unlocking creativity for the next generation of builders.

We’re a globally distributed, fully remote team of passionate engineers, designers, and creatives building the future of software development. If you love shipping fast, solving real problems, and pushing the boundaries of what’s possible we’d love to meet you.

About the Role

~1 min read

A hands-on technical leader who balances coding with leadership. You'll own frontend architecture, code quality, and team growth - spending significant time writing code while developing engineers and coordinating across teams.

Technical Leadership

  • Own UI architecture: component patterns, state management, performance, and frontend infrastructure
  • Write code regularly on complex features, migrations, and architectural improvements
  • Review all UI PRs and maintain quality standards across the domain
  • Drive technical initiatives and manage technical debt strategically
  • Coordinate with other Team Leads on cross-domain architectural decisions

Team Development

  • Conduct performance reviews and own career development for UI team members
  • Hold regular 1:1s to support growth, remove blockers, and provide feedback
  • Make hiring decisions and address performance issues proactively
  • Build a high-performing, autonomous team culture

Coordination

  • Assign team members across features based on skills, capacity, and priorities
  • Participate in coordination meetings with other Team Leads
  • Regular 1:1s with Head of Engineering to align on priorities and resources
  • Run weekly UI team meetings for knowledge sharing

AI-Native Development

  • Champion AI coding tools and model effective usage
  • Build AI-powered UI features and agent interaction patterns
  • Dogfood Bolt.new daily and drive product improvements

Requirements

~1 min read

Technical

  • 10+ years frontend development, 3+ years leadership
  • Expert in React, TypeScript, and modern frontend architecture
  • Strong HTML, CSS (Tailwind), performance optimization
  • Experience with design systems, state management, and complex UI flows
  • Track record of architectural decisions balancing speed and maintainability
  • Daily user of AI coding assistants (Cursor, Copilot, Claude)
  • Experience building AI-integrated applications and interfaces

Leadership

  • Performance reviews, career development, and difficult conversations
  • Growing engineers to senior/staff+ levels
  • Hiring frontend engineers
  • Building remote team culture
  • Coaching mindset with balance of individual and business needs

Skills

  • Strong UX sensibilities and eye for detail (spacing, typography, animations)
  • Experience with Figma/Sketch and translating designs to pixel-perfect interfaces
  • Excellent communication with technical and non-technical stakeholders
  • Pragmatic mindset: ship MVPs, bias toward action, match quality to business need
  • Business thinking: tie technical work to clear outcomes
  • Collaborative: knowledge sharing and unblocking others is core work

Nice to Have

~1 min read
  • Web Workers, Web Components, Remix, browser dev environments
  • Developer tooling or design tools experience
  • Design engineering background
  • Open-source contributions to UI libraries
  • WebAssembly or advanced browser APIs
  • You do not need a college degree to apply
  • You do not need to be located in the U.S. — we’re remote-friendly
  • You do not need to meet every qualification listed above

Location & Eligibility

Where is the job
Worldwide
Fully remote, anywhere in the world
Who can apply
Open to applicants worldwide
Listed under
Worldwide

Listing Details

First seen
March 26, 2026
Last seen
September 22, 2026

Posting Health

Days active
179
Repost count
0
Trust Level
30%
Scored at
September 22, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

StackblitzEngineering Manager - Front-End (UI/UX)