~4mo ago
New

Sr. Technical Program Manager

Hyderabad Indiasenior
OtherTechnical Program Manager
1 views0 saves0 applied

Quick Summary

Overview

Lyric is an AI-first, platform-based healthcare technology company, committed to simplifying the business of care by preventing inaccurate payments and reducing overall waste in the healthcare ecosystem, enabling more efficient use of resources to reduce the cost of care for payers, providers, and…

Requirements Summary

Required (quantifiable from resume/application): Bachelor’s degree in computer science, Engineering, Health Informatics, or a related field (Master’s preferred) Minimum of eight (8) years of technical program management experience, including a…

Technical Tools
awsconfluencejirasnowflakeagilehealthtechmachine-learningproject-managementstakeholder-management

Lyric is an AI-first, platform-based healthcare technology company, committed to simplifying the business of care by preventing inaccurate payments and reducing overall waste in the healthcare ecosystem, enabling more efficient use of resources to reduce the cost of care for payers, providers, and patients. Lyric, formerly ClaimsXten, is a market leader with 35 years of pre-pay editing expertise, dedicated teams, and top technology. Lyric is proud to be recognized as 2025 Best in KLAS for Pre-Payment Accuracy and Integrity and is HI-TRUST and SOC2 certified, and a recipient of the 2025 CandE Award for Candidate Experience. Interested in shaping the future of healthcare with AI? Explore opportunities at lyric.ai/careers and drive innovation with #YouToThePowerOfAI.

The Senior Manager, Technical Programs will manage these aspects of software development and delivery for Lyric:

  • Drive cross-team execution by coordinating engineering, product, and operations to deliver complex projects on time and within scope.
  • Bridge technical and business goals through deep technical understanding and strategic oversight, ensuring alignment and informed decision-making.
  • Mitigate risks and improves efficiency by identifying blockers early, optimizing processes, and scaling delivery frameworks as the company grows.

Responsibilities

~1 min read
  • →Program Leadership: Drive end-to-end delivery of large-scale programs focused on claim validation, pre- and post-pay analysis, audit automation, and payment recovery.
  • →Agile Execution: Lead Agile ceremonies across multiple scrum teams, facilitate continuous improvement, and ensure predictable delivery cycles.
  • →Domain Expertise: Collaborate with business stakeholders to understand complex payment policies, payer-provider relationships, coding standards (ICD-10, CPT, DRG), and integrate this understanding into program planning and execution.
  • →Technology Oversight: Partner with engineering to scope and deliver data-intensive solutions leveraging rules engines, machine learning models, and claims analytics platforms.
  • →Compliance & Risk Management: Ensure adherence to CMS, HIPAA, and payer-specific guidelines while managing program risks and mitigating operational bottlenecks.
  • →Stakeholder Management: Communicate effectively with internal teams (product, data, compliance, operations) and external partners (payers, auditors, regulators) to align on goals and timelines.
  • →Team Leadership: Mentor junior TPMs and contribute to building a high-performing, outcome-driven delivery culture.

Requirements

~1 min read

Required (quantifiable from resume/application):

  • Bachelor’s degree in computer science, Engineering, Health Informatics, or a related field (Master’s preferred)
  • Minimum of eight (8) years of technical program management experience, including a minimum of three (3) years in healthcare payment integrity, claims processing, or related systems
  • Minimum of eight (8) years experience leading Agile teams with strong understanding of Agile methodologies (Scrum, SAFe, Kanban)
  • Deep familiarity with claims lifecycle, payment integrity tools, FWA detection, and healthcare reimbursement models
  • Demonstrated ability to lead cross-functional teams and deliver complex technology solutions at scale
  • Experience with data-driven platforms, including those built on modern data architectures (e.g., Hadoop, Spark, Snowflake, or cloud-native)
  • Excellent communication, leadership, and stakeholder management skills
  • Proficiency with tools such as Jira, Confluence, AWS DevOps, or similar platforms

Location & Eligibility

Where is the job
Hyderabad India
On-site at the office
Who can apply
Same as job location

Listing Details

First seen
May 6, 2026
Last seen
October 3, 2026

Posting Health

Days active
0
Repost count
0
Trust Level
51%
Scored at
May 6, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

Sr. Technical Program Manager